DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12025 and Tmem230

DIOPT Version :10

Sequence 1:NP_647671.1 Gene:CG12025 / 38246 FlyBaseID:FBgn0035285 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_081754.2 Gene:Tmem230 / 70612 MGIID:1917862 Length:120 Species:Mus musculus


Alignment Length:82 Identity:23/82 - (28%)
Similarity:45/82 - (54%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PKVRENWRTVLAAFTLLVVGTGLFVMGTFAIA---DPQNTSQGVVFFVAGLICFIPGAYHVVYIW 152
            ||:  .::.:..|..|.::||.|.::|:..::   ......:.|...:.|::.|:||.||:...:
Mouse    39 PKI--PYKAIALATVLFLIGTFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAY 101

  Fly   153 LAAKGYRGFDFYHLPLF 169
            .|:|||||:.:..:|.|
Mouse   102 YASKGYRGYSYDDIPDF 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12025NP_647671.1 TMEM_230_134 61..169 CDD:399128 22/80 (28%)
Tmem230NP_081754.2 TMEM_230_134 2..118 CDD:399128 22/80 (28%)

Return to query results.
Submit another query.