DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12025 and Tmem134

DIOPT Version :9

Sequence 1:NP_001261296.1 Gene:CG12025 / 38246 FlyBaseID:FBgn0035285 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001072117.1 Gene:Tmem134 / 66990 MGIID:1914240 Length:195 Species:Mus musculus


Alignment Length:186 Identity:52/186 - (27%)
Similarity:84/186 - (45%) Gaps:25/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FSIHDAFE--------EETDEAIRVYGSTVISTPMRGKQGRSTEDVSIRIQDPKGYNKYAEDTTS 65
            |||.||||        |.....:..:|........|.:.....:...:|.|:.:.....|:.:..
Mouse     8 FSIDDAFELTLEDAGPEPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPE 72

  Fly    66 RDSDSLIQEYGNLPTEET---------------NTYC-W-RHPKVRENWRTVLAAFTLLVVGTGL 113
            .|.....::.|::....:               |..| | :||.:::|.|.|||:|.||::|..|
Mouse    73 PDGGVSTRDSGHMSVRSSQWSFSTISSSTQRSYNACCSWTQHPLIQKNRRVVLASFLLLLLGLVL 137

  Fly   114 FVMGTFAIADPQNTSQGVVFFVAGLICFIPGAYHVVYIWLAAKGYRGFDFYHLPLF 169
            .::|......|.......:|||.|::..:||.|||::|:.|.||.|||.|::||.|
Mouse   138 ILVGVGLEVAPSPGVSSAIFFVPGILLLVPGVYHVIFIYCAVKGRRGFQFFYLPYF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12025NP_001261296.1 DUF872 61..169 CDD:399128 38/124 (31%)
Tmem134NP_001072117.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..33 3/18 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..84 4/35 (11%)
DUF872 57..193 CDD:283547 40/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847113
Domainoid 1 1.000 78 1.000 Domainoid score I8795
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5221
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008408
OrthoInspector 1 1.000 - - oto92420
orthoMCL 1 0.900 - - OOG6_110165
Panther 1 1.100 - - LDO PTHR13558
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5767
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.