DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12025 and tmem134

DIOPT Version :9

Sequence 1:NP_001261296.1 Gene:CG12025 / 38246 FlyBaseID:FBgn0035285 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_956663.1 Gene:tmem134 / 393340 ZFINID:ZDB-GENE-040426-1345 Length:206 Species:Danio rerio


Alignment Length:210 Identity:62/210 - (29%)
Similarity:83/210 - (39%) Gaps:59/210 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FSIHDAFEEETDEAIRVYGSTVISTPMRGK-QGRSTEDVSIRIQDPKGYNKYAEDTTSRDSDSL- 71
            |:|.|||..|.:|      ..|:.....|: :||..:........|..:.|    |.|..|.|. 
Zfish     5 FTIDDAFVLEGEE------EGVVPEEDAGEWKGREKDGSGEMTFGPLSFTK----TQSHPSGSAG 59

  Fly    72 -----IQEYGNLPTEE--------------------TNTYC---------------------W-R 89
                 ..:|.||..|:                    |.:||                     | .
Zfish    60 TPEHSNLKYQNLENEDALGGTVNSSFNNFFKISDPATLSYCSSQWSFSTLSSVTQLSAHCCGWTS 124

  Fly    90 HPKVRENWRTVLAAFTLLVVGTGLFVMGTFAIADPQNTSQGVVFFVAGLICFIPGAYHVVYIWLA 154
            ||.|::|.|.|||:|.||:.|..|...|.....:|.......:|||.|.:.||||.|||:||..|
Zfish   125 HPLVKKNRRVVLASFLLLITGVALIFTGIVIQLNPHAGVSSAIFFVPGFLLFIPGVYHVIYISCA 189

  Fly   155 AKGYRGFDFYHLPLF 169
            .:|.|||.|::||.|
Zfish   190 VRGRRGFKFFYLPYF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12025NP_001261296.1 DUF872 61..169 CDD:399128 48/155 (31%)
tmem134NP_956663.1 DUF872 68..204 CDD:283547 44/135 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592330
Domainoid 1 1.000 80 1.000 Domainoid score I8578
eggNOG 1 0.900 - - E1_KOG4753
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1469582at2759
OrthoFinder 1 1.000 - - FOG0008408
OrthoInspector 1 1.000 - - oto41312
orthoMCL 1 0.900 - - OOG6_110165
Panther 1 1.100 - - LDO PTHR13558
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5767
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.