| Sequence 1: | NP_001261296.1 | Gene: | CG12025 / 38246 | FlyBaseID: | FBgn0035285 | Length: | 170 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001072115.1 | Gene: | Tmem134 / 361695 | RGDID: | 1305824 | Length: | 195 | Species: | Rattus norvegicus |
| Alignment Length: | 204 | Identity: | 55/204 - (26%) |
|---|---|---|---|
| Similarity: | 84/204 - (41%) | Gaps: | 61/204 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 FSIHDAFEEETDEAIRVYGSTVISTPMRGKQGRSTEDVSIRIQDPKGYNKYAE-DTTSRDSDSLI 72
Fly 73 QEYGNLPTEET----------------------------------------NTYC-W-RHPKVRE 95
Fly 96 NWRTVLAAFTLLVVGTGLFVMGTFAIADPQNTSQGVVFFVAGLICFIPGAYHVVYIWLAAKGYRG 160
Fly 161 FDFYHLPLF 169 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12025 | NP_001261296.1 | DUF872 | 61..169 | CDD:399128 | 42/150 (28%) |
| Tmem134 | NP_001072115.1 | DUF872 | 57..193 | CDD:399128 | 40/135 (30%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166350623 | |
| Domainoid | 1 | 1.000 | 78 | 1.000 | Domainoid score | I8584 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG4753 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1469582at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0008408 | |
| OrthoInspector | 1 | 1.000 | - | - | oto95985 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_110165 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR13558 |
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 10 | 9.710 | |||||