DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12025 and TMEM230

DIOPT Version :9

Sequence 1:NP_001261296.1 Gene:CG12025 / 38246 FlyBaseID:FBgn0035285 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_024307647.1 Gene:TMEM230 / 29058 HGNCID:15876 Length:190 Species:Homo sapiens


Alignment Length:70 Identity:14/70 - (20%)
Similarity:32/70 - (45%) Gaps:14/70 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PKGYNKYAEDTTSRDSDSLIQEYGNLPTEETNTYCWRHPKVRENWRTVLAAFTLLVVGTGLFVMG 117
            |....||:..:::.|.      |.:|..::|      .||:  .::.:..|..|.::|..|.::|
Human    76 PSSKVKYSRLSSTDDG------YIDLQFKKT------PPKI--PYKAIALATVLFLIGAFLIIIG 126

  Fly   118 TFAIA 122
            :..::
Human   127 SLLLS 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12025NP_001261296.1 DUF872 61..169 CDD:399128 11/62 (18%)
TMEM230XP_024307647.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4753
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5767
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.