powered by:
Protein Alignment CG12025 and TMEM230
DIOPT Version :9
Sequence 1: | NP_001261296.1 |
Gene: | CG12025 / 38246 |
FlyBaseID: | FBgn0035285 |
Length: | 170 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024307647.1 |
Gene: | TMEM230 / 29058 |
HGNCID: | 15876 |
Length: | 190 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 14/70 - (20%) |
Similarity: | 32/70 - (45%) |
Gaps: | 14/70 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 PKGYNKYAEDTTSRDSDSLIQEYGNLPTEETNTYCWRHPKVRENWRTVLAAFTLLVVGTGLFVMG 117
|....||:..:::.|. |.:|..::| .||: .::.:..|..|.::|..|.::|
Human 76 PSSKVKYSRLSSTDDG------YIDLQFKKT------PPKI--PYKAIALATVLFLIGAFLIIIG 126
Fly 118 TFAIA 122
:..::
Human 127 SLLLS 131
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12025 | NP_001261296.1 |
DUF872 |
61..169 |
CDD:399128 |
11/62 (18%) |
TMEM230 | XP_024307647.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4753 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5767 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.