DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12025 and acot8

DIOPT Version :10

Sequence 1:NP_647671.1 Gene:CG12025 / 38246 FlyBaseID:FBgn0035285 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_002932556.1 Gene:acot8 / 100495154 XenbaseID:XB-GENE-963979 Length:317 Species:Xenopus tropicalis


Alignment Length:55 Identity:14/55 - (25%)
Similarity:23/55 - (41%) Gaps:9/55 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RVYGSTVISTPMRGKQGRSTEDVS--------IRIQDPKGYNKYAEDTTSRDSDS 70
            |::|..::...:.......:|||:        :|..|||....|..:.| ||..|
 Frog    52 RLFGGQIVGQALVAAASSVSEDVNVHSLHCYFVRAGDPKIPVLYQVERT-RDGRS 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12025NP_647671.1 TMEM_230_134 61..169 CDD:399128 4/10 (40%)
acot8XP_002932556.1 tesB 33..307 CDD:272951 14/55 (25%)

Return to query results.
Submit another query.