DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and YPT53

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_014306.3 Gene:YPT53 / 855631 SGDID:S000005037 Length:220 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:59/178 - (33%)
Similarity:95/178 - (53%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSY-RKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            |:|:||...||||::.::||...|.|..:|||..:: .|::..||:....||.||||.|:|..:.
Yeast    14 KVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQERFAPLA 78

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDL------EEERVVG 127
            .:|.:|.|..::|:.:|.:.:|...|:..|: |..|...|:.:.|||||.||      .|.|.:.
Yeast    79 PMYYRNAQAALVVFDVTNEGSFYKAQNWVEE-LHEKVGHDIVIALVGNKMDLLNNDDENENRAMK 142

  Fly   128 KELGKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKK 175
            ....:||..:.|..:.|.|||...|:..||..|..::  ..||:..::
Yeast   143 APAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKV--PCPEQNTRQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 57/166 (34%)
YPT53NP_014306.3 Rab5_related 12..180 CDD:206653 57/168 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.