DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and RABA6a

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_177505.1 Gene:RABA6a / 843698 AraportID:AT1G73640 Length:233 Species:Arabidopsis thaliana


Alignment Length:167 Identity:59/167 - (35%)
Similarity:94/167 - (56%) Gaps:8/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTI--EDSYRKQVEVDGQQCMLEILDTAGTEQFTA 66
            :|.|::|...||||.|..:|.:..|.....|||  |.:|| .|.|..:....:|.||||.|:|.|
plant    14 FKAVLIGDSAVGKSNLLSRFSKDEFRFDSKPTIGVEFAYR-NVHVGDKIIKAQIWDTAGQERFRA 77

  Fly    67 MRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKD--TDDVPMVLVGNKCDLEEERVVGKE 129
            :...|.:...|.:|:|.||.::||:   ::::.:..::|  ..:..:||||||.||.:.|.|.::
plant    78 ITSSYYRGALGALLIYDITRRTTFD---NIKKWLFELRDFANPETVVVLVGNKSDLRQSREVEED 139

  Fly   130 LGKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINK 166
            .||.||......|:||||...|||.:.|..::.:|::
plant   140 EGKTLAESEGLYFLETSALENVNVEEAFLVMIGRIHE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 58/164 (35%)
RABA6aNP_177505.1 Rab11_like 11..175 CDD:206660 58/164 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.