DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and Rasd2

DIOPT Version :10

Sequence 1:NP_476857.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_083458.1 Gene:Rasd2 / 75141 MGIID:1922391 Length:266 Species:Mus musculus


Alignment Length:167 Identity:66/167 - (39%)
Similarity:102/167 - (61%) Gaps:10/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            |::||||:..||||::..:|:...|.::|.|||||.:||...:.|....|:||||:|...|.|||
Mouse    20 YRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMR 84

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRV--------KDTDDVPMVLVGNKCDLEE--E 123
            .|.:..|..|:||:|:.::.:|::::.|::|||.|        |:..::|||:.|||.|..|  .
Mouse    85 RLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCR 149

  Fly   124 RVVGKELGKNLATQFNCAFMETSAKAKVNVNDIFYDL 160
            :|...|....::...|||:.|.|||...|||::||.|
Mouse   150 QVPAMEAELLVSGDENCAYFEVSAKKNTNVNEMFYVL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_476857.1 Rap1 3..165 CDD:133375 66/167 (40%)
Rasd2NP_083458.1 Rhes_like 20..266 CDD:133343 66/167 (40%)
Effector region 48..56 6/7 (86%)
Interaction with GNB1, GNB2 and GNB3. /evidence=ECO:0000250 189..235
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.