DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and Rras2

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_080122.2 Gene:Rras2 / 66922 MGIID:1914172 Length:204 Species:Mus musculus


Alignment Length:190 Identity:96/190 - (50%)
Similarity:133/190 - (70%) Gaps:9/190 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAM 67
            :|::||:|.|||||||||:||:|..||..|||||||||.||..:|.:...|:||||||.|:|.||
Mouse    14 KYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAM 78

  Fly    68 RDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGK 132
            |:.||:.|:||:||:|:|.:.:|.::...:.|||||||.|:.||:|:|||.||:.:|.|.:|.|:
Mouse    79 REQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQ 143

  Fly   133 NLATQFNCAFMETSAKAKVNVNDIFYDLVRQINK-------KSPE--KKQKKPKKSLCVL 183
            .||.|....:||.|||.::||:..|::|||.|.|       .|||  :|:|..|...||:
Mouse   144 QLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 86/161 (53%)
Rras2NP_080122.2 M_R_Ras_like 13..176 CDD:133345 86/161 (53%)
Effector region 43..51 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.