DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and ralab

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001007322.1 Gene:ralab / 492355 ZFINID:ZDB-GENE-041114-195 Length:202 Species:Danio rerio


Alignment Length:192 Identity:94/192 - (48%)
Similarity:134/192 - (69%) Gaps:12/192 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            :|::::|||||||||||:||:...|||.|:||..|||||:|.:||::..::||||||.|.:.|:|
Zfish    11 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 75

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKN 133
            |.|.::|:||:.|:|||...:|....|.||||||||:.::||.:|||||.|||:.|.||.|..|.
Zfish    76 DNYFRSGEGFLCVFSITESESFAATADFREQILRVKEEENVPFLLVGNKSDLEDRRQVGLEEAKA 140

  Fly   134 LATQFNCAFMETSAKAKVNVNDIFYDLVRQINKK----SPEKKQKKPKKSL--------CVL 183
            .|.|:..:::|||||.:.||:.:|:||:|:|..:    ..||..||.:|||        |:|
Zfish   141 RAEQWGVSYVETSAKTRANVDKVFFDLMREIRARKMEDGKEKNGKKKRKSLATRIRERCCIL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 84/160 (53%)
ralabNP_001007322.1 small_GTPase 11..174 CDD:197466 85/162 (52%)
RalA_RalB 11..173 CDD:206710 85/161 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.