DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and rap1aa

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001002152.1 Gene:rap1aa / 415242 ZFINID:ZDB-GENE-040625-167 Length:185 Species:Danio rerio


Alignment Length:185 Identity:161/185 - (87%)
Similarity:176/185 - (95%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||:|||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||
Zfish     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||||||||||||.|||||||||||||||||||||||||||:||||:|||||||||||||||||.
Zfish    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEEERVVGKEQ 130

  Fly   131 GKNLATQF-NCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLCVLL 184
            |:|||.|: ||||:|:|||:|:|||:||||||||||:|:|.:|::..|||.||||
Zfish   131 GQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKRAKKKSNCVLL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 147/162 (91%)
rap1aaNP_001002152.1 small_GTPase 2..168 CDD:197466 150/165 (91%)
Rap1 3..167 CDD:133375 148/163 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578096
Domainoid 1 1.000 294 1.000 Domainoid score I1469
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2162
Inparanoid 1 1.050 322 1.000 Inparanoid score I2489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - otm25097
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.