DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and rheb

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_957023.1 Gene:rheb / 393702 ZFINID:ZDB-GENE-040426-1690 Length:184 Species:Danio rerio


Alignment Length:162 Identity:68/162 - (41%)
Similarity:107/162 - (66%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRD 69
            ||.|||...||||:||:|||:..||:.||||||:::.|.:.|:||:..|:::||||.::::....
Zfish     8 KIAVLGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITVNGQEYHLQLVDTAGQDEYSIFPQ 72

  Fly    70 LYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKNL 134
            .|..:..|::||||:|:..:|..::.:.|::|.:.....||::|||||.||..|||:..|.||.|
Zfish    73 TYSIDINGYILVYSVTSNKSFEVVKVIHEKLLDMVGKVQVPIMLVGNKKDLHMERVISCEEGKAL 137

  Fly   135 ATQFNCAFMETSAKAKVNVNDIFYDLVRQINK 166
            |..:|.||||:|||......::|..::.:..|
Zfish   138 AESWNAAFMESSAKENQTAVEVFKRIILEAEK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 67/159 (42%)
rhebNP_957023.1 RheB 6..184 CDD:206709 68/162 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.