DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and Rras

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001101951.1 Gene:Rras / 361568 RGDID:1311443 Length:218 Species:Rattus norvegicus


Alignment Length:189 Identity:92/189 - (48%)
Similarity:122/189 - (64%) Gaps:8/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            :|:||:|.|||||||||:||:|..||..|||||||||.|...|||....|:||||||.|:|.|||
  Rat    30 HKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGAMR 94

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKN 133
            :.||:.|.||:||::|..:.:|.::..|..|||||||.||.|:||||||.|||.:|.|.:....:
  Rat    95 EQYMRAGNGFLLVFAINDRQSFIEVSKLFTQILRVKDRDDFPIVLVGNKADLETQRQVLRSEASS 159

  Fly   134 LATQFNCAFMETSAKAKVNVNDIFYDLVRQINK--------KSPEKKQKKPKKSLCVLL 184
            .:...:..:.|.|||.::||::.|..|||.:.|        ..|...:||..:..||||
  Rat   160 FSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAPRKKDGRCPCVLL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 84/160 (53%)
RrasNP_001101951.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 92/189 (49%)
P-loop_NTPase 28..191 CDD:304359 84/160 (53%)
small_GTPase 42..193 CDD:197466 76/150 (51%)
Effector region 58..66 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.