DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and Rhebl1

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_038935288.1 Gene:Rhebl1 / 359959 RGDID:727778 Length:301 Species:Rattus norvegicus


Alignment Length:186 Identity:47/186 - (25%)
Similarity:86/186 - (46%) Gaps:37/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            :|..|:.:||...|||::|..|||:..|::.||||:|::|.|.|.:...:..|.::||||.::::
  Rat   139 VRYRKVAILGYRSVGKTSLAHQFVEGEFLKGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQDKYS 203

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKD-----------TDDVPMVLVGNKCD 119
            .:...::....|:||||::|:         ||..:..:..           |..:.:.|:     
  Rat   204 ILPYSFIIGVHGYVLVYNVTS---------LRRYVTGILSGGSSRLTSNPRTKTIALFLM----- 254

  Fly   120 LEEERVVGKELGKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKK 175
                    .|..|:|.|   |......|..|::.....:. .|||:.::...:|.|
  Rat   255 --------SEASKSLRT---CTKSYRKAMVKLDCQCCLWG-TRQISLQTERCRQLK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 43/172 (25%)
Rhebl1XP_038935288.1 P-loop_NTPase 141..>226 CDD:422963 30/93 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.