DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and Mras

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_038936811.1 Gene:Mras / 25482 RGDID:3111 Length:236 Species:Rattus norvegicus


Alignment Length:195 Identity:98/195 - (50%)
Similarity:134/195 - (68%) Gaps:14/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            ||:||:|.|||||||||:||.|.|||..|||||||||.|..|:|.|..:|::|||||.|:|:|||
  Rat    42 YKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMR 106

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKN 133
            :.||:.|.||::|||:|.:::|..:....:.||||||.:..||:||.||.||...|.:.::.||.
  Rat   107 EQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKITRDQGKE 171

  Fly   134 LATQFNCAFMETSAK-AKVNVNDIFYDLVRQINKKSPEKKQKKPKKS-------------LCVLL 184
            :||::|..::||||| ..:||:..|:||||.|.::.|||.|||.||:             .||:|
  Rat   172 MATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL 236

  Fly   185  184
              Rat   237  236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 86/161 (53%)
MrasXP_038936811.1 M_R_Ras_like 40..204 CDD:133345 86/161 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.