DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and Gm266

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001028420.2 Gene:Gm266 / 212539 MGIID:2685112 Length:200 Species:Mus musculus


Alignment Length:176 Identity:68/176 - (38%)
Similarity:116/176 - (65%) Gaps:1/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 REYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTA 66
            ::|::|||||..|||:||..||....|.|:.:|::|:.:.|.:||:....:|||:||.|.|....
Mouse    10 KDYRVVVLGSVAVGKTALATQFACGRFPERCEPSVEELFSKVIEVNRAPALLEIVDTVGAEHLVT 74

  Fly    67 MRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELG 131
            ::|||::|..|||::||:..:::|..::.|||::.|::.:..||:||||.|.||:.||.|....|
Mouse    75 LKDLYIRNSDGFVVLYSVCDEASFQAVRPLRERMGRLRGSRAVPLVLVGTKADLDAERQVLTAQG 139

  Fly   132 KNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPK 177
            :.||.::.|.|:|.:.|:|..|:.:|..:||::...:| ..|:.|:
Mouse   140 RALAREWRCPFLEITTKSKTMVDHVFTQVVREMEALAP-PGQEAPR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 65/161 (40%)
Gm266NP_001028420.2 small_GTPase 10..173 CDD:197466 65/162 (40%)
P-loop_NTPase 11..172 CDD:304359 65/160 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.