DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and rap-1

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_501549.1 Gene:rap-1 / 177709 WormBaseID:WBGene00004307 Length:188 Species:Caenorhabditis elegans


Alignment Length:183 Identity:153/183 - (83%)
Similarity:169/183 - (92%) Gaps:2/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||||||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||
 Worm     1 MREYKIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            ||||||||||||||||||||||||||||.|||:|||||||||:|||:|||||||||:||||||:.
 Worm    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLMDLRDQILRVKDTDEVPMILVGNKCDLEDERVVGKDQ 130

  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPE--KKQKKPKKSLC 181
            |:|||.||..||:|||||||:||:::|||||||||::.||  ::|.:..|..|
 Worm   131 GQNLARQFGSAFLETSAKAKINVSEVFYDLVRQINRRYPESGRRQGQSNKQCC 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 144/161 (89%)
rap-1NP_501549.1 Rap1 3..166 CDD:133375 145/162 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158419
Domainoid 1 1.000 291 1.000 Domainoid score I827
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 307 1.000 Inparanoid score I1580
Isobase 1 0.950 - 0 Normalized mean entropy S256
OMA 1 1.010 - - QHG53521
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - oto19037
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X266
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.