DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and ral-1

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001254866.1 Gene:ral-1 / 175433 WormBaseID:WBGene00021811 Length:254 Species:Caenorhabditis elegans


Alignment Length:196 Identity:89/196 - (45%)
Similarity:137/196 - (69%) Gaps:15/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            :|::::|:|||||||||:||:...|||:|:||..|||||:|.:||::|.::||||||.|.::|:|
 Worm    59 HKVIMVGTGGVGKSALTLQFMYDEFVEEYEPTKADSYRKKVVLDGEECSIDILDTAGQEDYSAIR 123

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTD-DVPMVLVGNKCDLEEERVVGKELGK 132
            |.|.::|:||:.|:||....:|....:.||||||||::| .||:||||||.|:.::|||..||.:
 Worm   124 DNYYRSGEGFICVFSILDMESFEATNEFREQILRVKNSDSSVPIVLVGNKGDMRDQRVVSAELCR 188

  Fly   133 NLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKK--------------SPEKKQKKPKKSLCVL 183
            ..|.|:.|.::|||||.:.||:.:||||:|::.::              |..:|::...|..|.:
 Worm   189 QRAEQWGCHYVETSAKRRENVDKVFYDLMREMKRRKGGSQAQTGIDASASSGRKKRSGIKKHCTI 253

  Fly   184 L 184
            |
 Worm   254 L 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 84/161 (52%)
ral-1NP_001254866.1 RAS 59..223 CDD:214541 84/163 (52%)
RalA_RalB 59..222 CDD:206710 84/162 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.