DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and Mras

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_032650.1 Gene:Mras / 17532 MGIID:1100856 Length:208 Species:Mus musculus


Alignment Length:195 Identity:99/195 - (50%)
Similarity:134/195 - (68%) Gaps:14/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            ||:||:|.|||||||||:||.|.|||..|||||||||.|..|:|.|..:|::|||||.|:|:|||
Mouse    14 YKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMR 78

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKN 133
            :.||:.|.||::|||:|.:::|..:....:.||||||.:..||:||.||.||...|.|.::.||.
Mouse    79 EQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKE 143

  Fly   134 LATQFNCAFMETSAK-AKVNVNDIFYDLVRQINKKSPEKKQKKPKKS-------------LCVLL 184
            :||::|..::||||| ..:||:..|:||||.|.::.|||.|||.||:             .||:|
Mouse   144 MATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQVPEKNQKKKKKTKWRGDRATGTHKLQCVIL 208

  Fly   185  184
            Mouse   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 87/161 (54%)
MrasNP_032650.1 M_R_Ras_like 12..176 CDD:133345 87/161 (54%)
Effector region 42..50 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.