DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and ras-1

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_496623.1 Gene:ras-1 / 174875 WormBaseID:WBGene00004310 Length:212 Species:Caenorhabditis elegans


Alignment Length:188 Identity:89/188 - (47%)
Similarity:127/188 - (67%) Gaps:17/188 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRD 69
            :|||:|.|||||||||:||:|..||:.|||||||||.||..||...|.||||||||.|:|:.||:
 Worm    19 RIVVVGGGGVGKSALTIQFIQRYFVQDYDPTIEDSYTKQCFVDEDLCKLEILDTAGQEEFSTMRE 83

  Fly    70 LYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKNL 134
            .|::.|.||::|:::|.:::|.:::.|.|.|.|:||.||.|::|||||.|||.||.|.:...:.|
 Worm    84 QYLRTGSGFLIVFAVTDRNSFEEVKKLHELICRIKDRDDFPIILVGNKADLENERHVARHEAEEL 148

  Fly   135 ATQFNCAFMETSAKAKVNVNDIFYDLVRQINK-----------------KSPEKKQKK 175
            |.:.:..::|.|||.:.||::.|:|:||.:.|                 :||.|.:||
 Worm   149 AHRLSIPYLECSAKIRKNVDEAFFDIVRLVRKYQHDERMPIHPHDDRKLESPIKLKKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 83/159 (52%)
ras-1NP_496623.1 small_GTPase 30..181 CDD:197466 75/150 (50%)
M_R_Ras_like 30..179 CDD:133345 75/148 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.