DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and rap1a

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001096357.1 Gene:rap1a / 100124947 XenbaseID:XB-GENE-5801166 Length:185 Species:Xenopus tropicalis


Alignment Length:185 Identity:158/185 - (85%)
Similarity:175/185 - (94%) Gaps:1/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||:|||||||||||||||||||.||||||||||||||||||||:||||||||||||||||||
 Frog     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVEGQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||||||||||||.|||||||||||||||||||||||||||:||||:|||||||||:|||||||.
 Frog    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQ 130

  Fly   131 GKNLATQF-NCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLCVLL 184
            |:|||.|: ||||:|:|||:|:|||:||||||||||:|:|.:|:|..||..|:||
 Frog   131 GQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPGKKPKCLLL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 145/162 (90%)
rap1aNP_001096357.1 Rap1 3..167 CDD:133375 146/163 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 294 1.000 Domainoid score I1474
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2162
Inparanoid 1 1.050 317 1.000 Inparanoid score I2499
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - otm48114
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X266
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.