DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and rap2ab

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001139177.1 Gene:rap2ab / 100003903 ZFINID:ZDB-GENE-090312-116 Length:183 Species:Danio rerio


Alignment Length:182 Identity:110/182 - (60%)
Similarity:142/182 - (78%) Gaps:3/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||:||||||||||||||||||...|:|||||||||.|||::|||....:||||||||||||.
Zfish     1 MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            :|||||:||||||:||||:..|.:|.|::.:|:||:|||..:.||::|||||.||:.||.|....
Zfish    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPVILVGNKVDLDNEREVSSSE 130

  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKS-PEKKQKKPKKSLC 181
            |:.||.::.|.|||||||:|..|:::|.::|||::..| |:|:.  |..|.|
Zfish   131 GQALAEEWGCPFMETSAKSKTMVDELFSEIVRQMDYASQPDKED--PCCSSC 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 102/161 (63%)
rap2abNP_001139177.1 Rap2 16..165 CDD:133376 90/148 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X266
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.