DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bc and Ccp84Ab

DIOPT Version :10

Sequence 1:NP_647668.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:201 Identity:83/201 - (41%)
Similarity:105/201 - (52%) Gaps:25/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKSLICLAVLSAASAGVLHGHGAGLYAAAPAIYAGHGHHDEGI----------DYHAYPKYHYNY 58
            ||.:..||.::.||||........:|.||||: |.:.|....:          :|..:|:|.::|
  Fly     3 FKFVFALAFVAVASAGYAPIAAPQVYHAAPAV-ATYAHAPVAVAQKVVVKAAEEYDPHPQYRFSY 66

  Fly    59 GVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHK--------TGP 115
            ||.|..|||.|.|.|.||||||:|.|||::.||..|||:||||..|||||||::        ..|
  Fly    67 GVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAP 131

  Fly   116 TVHHAAPAVVAHAAPAVVH-AAPAYAPAIA--HHVAAAPAVPYAGSLAHQVPAYGYATHNAHAHV 177
            .|...|..|..:|||||.| ||||....:|  .|.||...|.....:||......|||:.|..|.
  Fly   132 VVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAYATYAAPTHY 196

  Fly   178 ---AHY 180
               |||
  Fly   197 AAPAHY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BcNP_647668.1 Chitin_bind_4 54..106 CDD:459790 31/51 (61%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:459790 31/51 (61%)

Return to query results.
Submit another query.