DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bc and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:133 Identity:57/133 - (42%)
Similarity:68/133 - (51%) Gaps:34/133 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAVLSAASAGVLHG------HGAGLYAAAPAIYAGHGH--------------------------H 42
            ||.|.::.:|..||      .|||.|..||::.|...|                          |
  Fly  1082 LAHLDSSLSGYSHGVGGIGPLGAGFYRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKH 1146

  Fly    43 DEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFN 107
            .|..|  |:|:|.:.|.|.|.||||.|.|.|.||||||||.||||||||:||||:|.||...||:
  Fly  1147 LEHFD--AHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFH 1209

  Fly   108 AVV 110
            |.|
  Fly  1210 AEV 1212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 34/51 (67%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D634603at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.