DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bc and Cpr76Bb

DIOPT Version :9

Sequence 1:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster


Alignment Length:175 Identity:77/175 - (44%)
Similarity:85/175 - (48%) Gaps:48/175 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLSAASAGVLHGHGAGLYAAAPAIYAGHGHHDEGIDY-----HAYPKYHYNYGVADSHTGDVKSQ 71
            |:||  .|.::|||          |...||...|..|     |.||||.::|||.|:||||.|||
  Fly    51 VVSA--YGGIYGHG----------YPSVGHSGYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQKSQ 103

  Fly    72 HEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTVHHAAPAVVAHAAPAVVHAA 136
            .|.||||.|||||||.|.||:.|.|||||||||||||||.|.| ..||          |.|.|..
  Fly   104 WETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNAVVKKLG-HAHH----------PQVYHKG 157

  Fly   137 PAYAP------AIAHHVAAAPAVPYAGSLAHQVPAYGYATHNAHA 175
            ..:..      ...|.||     .|.|        |||. |..||
  Fly   158 YGHGDIYDADYGYGHDVA-----QYGG--------YGYG-HGGHA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 37/51 (73%)
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:278791 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.