DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bc and Cpr64Ac

DIOPT Version :9

Sequence 1:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:98 Identity:50/98 - (51%)
Similarity:59/98 - (60%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHK 112
            |...|:|.::|||.|.||||.|.|.|.....||.|||||.||||::|.|.||||..|||||||.|
  Fly    86 YDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEK 150

  Fly   113 TG-PTVHHAAPAVVAHAAPAVVHAAPAYAPAIA 144
            .| ..|..|.||:...|.||:.....|.||.::
  Fly   151 KGVAAVAIAKPALAVAAVPAITKIGYASAPGLS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 30/51 (59%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.