DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bc and CG42367

DIOPT Version :9

Sequence 1:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster


Alignment Length:108 Identity:46/108 - (42%)
Similarity:59/108 - (54%) Gaps:21/108 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIC--LAVLSAASAGVLHGHGAGLYAAAPAIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVK 69
            :||  |:.|.|..||::..|...| .|:||                  :|.::|.|.|||:||||
  Fly     9 VICLILSALVAVQAGIIASHPDEL-IASPA------------------QYEFHYSVHDSHSGDVK 54

  Fly    70 SQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHK 112
            .|.|.|.|:.|.|.||||:|||..|.|:||||...||||.|.:
  Fly    55 DQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQVRR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 29/51 (57%)
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:278791 27/46 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.