DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Lcp65Ag3

DIOPT Version :10

Sequence 1:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:135 Identity:36/135 - (26%)
Similarity:47/135 - (34%) Gaps:43/135 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVILSLALFASVAVARPG-----YALDYYDHPKYAFNY------GVADHSTGDVKSQHETRDGDV 60
            |:|:.:|||| ||:|.|.     ......|....:|.|      |.|..:.|.:.......:...
  Fly     3 FLIVFVALFA-VALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAIS 66

  Fly    61 VKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVVASPIVAHKPVLTHYEPQVVKH 125
            |.|.|..:..||....|:|.||. :||                  .|..||.|            
  Fly    67 VSGSYRFIADDGQTYQVNYIADK-NGF------------------QPEGAHLP------------ 100

  Fly   126 VAPVA 130
            |||||
  Fly   101 VAPVA 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 14/57 (25%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.