DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr92A

DIOPT Version :9

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:198 Identity:80/198 - (40%)
Similarity:96/198 - (48%) Gaps:50/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RPGYALDYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHG 86
            :|.....|...|||:|.|.:.|..|||:|||||||.||||||.||:|:|||:.||||||||..||
  Fly    55 KPAAPEPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHG 119

  Fly    87 FNAVVTKSGPTVHAQAVVASPIV--AHKPVLTHYEPQVVKHVAPVAHAPLV------------VA 137
            |||||.|. |..:......:|:|  |..||..||.|.....:.||..|||:            ..
  Fly   120 FNAVVRKE-PLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPLLSYPLALGPYHRGAP 183

  Fly   138 SPAPYVAKHYAPA-----AAAPIHYDYDDGYYNQGQQYEYIPQYDQYSGHYGHYA------SPYA 191
            :|||..|...|||     .|.|:                 :|     |.|: |.|      ||||
  Fly   184 APAPGPAPAPAPAPVSVPVATPV-----------------LP-----SAHF-HAAYPALAHSPYA 225

  Fly   192 GHY 194
             ||
  Fly   226 -HY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 35/51 (69%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 7/21 (33%)
Chitin_bind_4 68..120 CDD:278791 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.