DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Ccp84Ae

DIOPT Version :9

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:172 Identity:73/172 - (42%)
Similarity:97/172 - (56%) Gaps:40/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VILSLALF-----------ASVAVAR---PGYA----LDYYD-HPKYAFNYGVADHSTGDVKSQH 53
            ::::||||           |.||||.   |..|    |:..| ||:|.::|.|.|..:||.|...
  Fly     5 IVIALALFAVAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHV 69

  Fly    54 ETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKS--GPTVHAQAV--VASPIVAHKPV 114
            |.||||||:|:|||::.||..|||.||||||:||||||.:.  ...|.|:.:  ||:|:|...| 
  Fly    70 EERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLLKVAAPLVKAAP- 133

  Fly   115 LTHYEPQVVKHVAPVAHAPLVVASPAPYVAKHYAP-AAAAPI 155
                       |||:  ||:.:|:|||.|..  || |.|||:
  Fly   134 -----------VAPI--APVALAAPAPIVRS--APVAVAAPL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 29/51 (57%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.