DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr78Cc

DIOPT Version :10

Sequence 1:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:125 Identity:30/125 - (24%)
Similarity:46/125 - (36%) Gaps:32/125 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSLALFASVAVARPGYA----------------LDYYDHPKYAF--NYGVADHSTGDVKSQHETR 56
            |||.|.|::.:|.. ||                .|...:.:|||  :.|:.....|:|..     
  Fly     4 LSLCLLAALMLANV-YADNINKDAVITREDVNPADAEGNYQYAFETSNGIQAQEAGNVNG----- 62

  Fly    57 DGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAV---VTKSGPTVHAQAVVASPIVAHKP 113
                :.|..|.:.|:|...::.|.||. :||...   :..:.|...|.......|.||.|
  Fly    63 ----ISGSSSYISPEGVPISLTYVADE-NGFQPQGDHLPTAPPIPEAILRALEYIAAHPP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 13/53 (25%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 13/55 (24%)

Return to query results.
Submit another query.