powered by:
Protein Alignment Cpr62Bb and Cpr76Bd
DIOPT Version :9
Sequence 1: | NP_001137869.1 |
Gene: | Cpr62Bb / 38240 |
FlyBaseID: | FBgn0035280 |
Length: | 194 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262052.1 |
Gene: | Cpr76Bd / 40123 |
FlyBaseID: | FBgn0036881 |
Length: | 1231 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 44/73 - (60%) |
Similarity: | 52/73 - (71%) |
Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 PGYALDYYD-HPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHG 86
|...|:::| ||:|||.|.|.|..|||.|.|.|.||||||||:||||||||::|||.|.||...|
Fly 1143 PEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETG 1207
Fly 87 FNAVVTKS 94
|:|.|..|
Fly 1208 FHAEVINS 1215
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D634603at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.020 |
|
Return to query results.
Submit another query.