DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr76Bc

DIOPT Version :9

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster


Alignment Length:219 Identity:74/219 - (33%)
Similarity:95/219 - (43%) Gaps:60/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTK 93
            :|:|..|||:|||.|..|||||||.|:||||.|||.||::|||||||||.||||:..||||:|..
  Fly    50 HYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKT 114

  Fly    94 SGPTVH----------------------------AQAVVASPIVAHKPV------LTHYEPQV-- 122
            .|...|                            ...|::|.|   ||:      |||..|:|  
  Fly   115 VGANSHPITESPEGSNQVNDDTSQSKINHYSKDQEHIVLSSDI---KPLKRPIEDLTHSHPKVPS 176

  Fly   123 VKHVAPVAHAPLVVASPAPYVA--------KHYAPAAAAPIHYDY----------DDGYYNQ--- 166
            :..:.|.|....|.....|.:.        .:|...|||....||          .:|.:..   
  Fly   177 LIEIKPHARIKQVPMDMDPGIRDRLQQARDTYYKQIAAAHKLEDYSQKLQPTYAVQEGDWKAVIV 241

  Fly   167 GQQYEYIPQYDQYSGHYGHYASPY 190
            .:..||.|.|...|..:.|:...|
  Fly   242 NEPKEYRPHYTTGSPAHSHFYDHY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 37/51 (73%)
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.