DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr72Eb

DIOPT Version :9

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:229 Identity:57/229 - (24%)
Similarity:86/229 - (37%) Gaps:78/229 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCFVILSLALFASVAVARPGYALDY-----------Y----DHPKYAFNYGVADHSTGDVKSQHE 54
            :|.:..::.|    ||..|  .|:|           |    :|.:||:.|      ...:.|:||
  Fly     6 LCLICTTIGL----AVGSP--TLEYGPPPTSDTISQYHHQDEHGQYAYGY------MAPLYSKHE 58

  Fly    55 TRDGD-VVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVVASPIVAHKPVLTHY 118
            ||..| |::|.:|.::.:|..:||||.||: .||:  ||.:.|  :.||...:|.||.... .|.
  Fly    59 TRTVDGVIRGTFSHIDANGETQTVDYVADA-EGFH--VTSNLP--NQQANQETPEVAALRT-QHL 117

  Fly   119 E----------------PQVVKHVAPVAHAP----------------------LVVASPAPYVAK 145
            |                ||.|:....||.|.                      ||:.:|.|...:
  Fly   118 EAHNQAKLRLAGDYSVGPQPVRDTPEVAAAKVAFFKRFEAEKLRNKLLAEKKVLVIPNPTPIAVR 182

  Fly   146 H-----YAPAAAAPIHYDYDDGYYNQGQQYEYIP 174
            .     |.|.....: |:|......|.....|:|
  Fly   183 SQPIYVYQPTTTGFV-YNYHTKTQAQVPSRNYLP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 19/52 (37%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.