DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and CG13670

DIOPT Version :9

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:167 Identity:52/167 - (31%)
Similarity:78/167 - (46%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GYALDYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFN 88
            |..:||...|:|:|.|||.|..|..::::.|||:||.|:|.||:|:|||::|.|.||||..:||.
  Fly    92 GRTVDYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQ 156

  Fly    89 A-VVTKSGPTVHAQ--------AVVASPIVAHKPVLTHYEPQVVKHVAPVAHAPLVVASPAPYVA 144
            | |:|....|:|..        ..|.|.               |:|.:..||.............
  Fly   157 AEVITNGVKTLHGHGSDGDAGGGSVDSQ---------------VRHHSAEAHKAKEDDEEEDERE 206

  Fly   145 KHYAPAAAAPIHYDYDDGYYNQGQQYEYIPQYDQYSG 181
            :.:.......:|.|||:|...|.::.|....:.:|.|
  Fly   207 REHQGNGQYQVHEDYDEGKDEQAEEDEEGGGHQEYEG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 26/51 (51%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:278791 26/51 (51%)
Paf1 <215..265 CDD:281915 9/29 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.