DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:153 Identity:32/153 - (20%)
Similarity:50/153 - (32%) Gaps:45/153 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANFVCFVILSLAL-------FASVAVARPGYALDYYDHPKYAFNYGVADHSTGDVKSQHETRDG 58
            |..|....:.:||:       |.:.|..|. |..|..:...||:.|    .::..:..|.....|
  Fly     1 MNKFFVLAVAALAVSCVQADSFDARAETRE-YKSDLKEDGSYAYQY----QTSNGIAGQESGVGG 60

  Fly    59 DVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVVASPIVAHKPVLTHYEPQVV 123
            ....|..:...|||.:..:.||||| :|::                  |..||.|.    .|.: 
  Fly    61 YYASGSNAYYAPDGQLIQLTYTADS-NGYH------------------PAGAHLPT----PPPI- 101

  Fly   124 KHVAPVAHAPLVVASPAPYVAKH 146
                     |..:.....|:..|
  Fly   102 ---------PASILKSLEYIRTH 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 14/51 (27%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 14/51 (27%)

Return to query results.
Submit another query.