DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr65Az

DIOPT Version :10

Sequence 1:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:58 Identity:15/58 - (25%)
Similarity:26/58 - (44%) Gaps:6/58 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YAFNY----GVADHSTGDVKSQH-ETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGF 87
            |.:.|    |:.....|.:|:.. |..:....:|.:|...|:|...::.|.||. :||
  Fly   129 YMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADE-NGF 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 13/56 (23%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 13/56 (23%)

Return to query results.
Submit another query.