DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Lcp65Ac

DIOPT Version :10

Sequence 1:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:103 Identity:33/103 - (32%)
Similarity:44/103 - (42%) Gaps:31/103 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CFV-ILSLALFASVAVARP------------------GY--ALDYYDHPKYAFNYGVADHSTGDV 49
            |.| |:..|||| |.:|.|                  ||  ||:..|..|:        ...|.:
  Fly     3 CTVAIVFTALFA-VVLAAPAPDADTQILRLESDVQPEGYNFALETSDGKKH--------EEQGQL 58

  Fly    50 KSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGF 87
            |:....::..||:|.||.|..||...||:|.||. :||
  Fly    59 KNVGTEQEAIVVRGSYSFVADDGQTYTVNYIADE-NGF 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 15/51 (29%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 20/63 (32%)

Return to query results.
Submit another query.