DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr62Bc

DIOPT Version :9

Sequence 1:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster


Alignment Length:209 Identity:89/209 - (42%)
Similarity:108/209 - (51%) Gaps:51/209 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NFVCFVILSLA-----------LFASVAVARPGY-----ALDYYDHPKYAFNYGVADHSTGDVKS 51
            :.:|..:||.|           |:|:......|:     .:||:.:|||.:||||||..||||||
  Fly     6 SLICLAVLSAASAGVLHGHGAGLYAAAPAIYAGHGHHDEGIDYHAYPKYHYNYGVADSHTGDVKS 70

  Fly    52 QHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVVASPIVAHKPVLT 116
            |||.||||||||.|||||||||:|||:||||..:||||||.|:|||||                 
  Fly    71 QHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTVH----------------- 118

  Fly   117 HYEPQVVKHVAP-VAHAPLVVASPAPYVAKHYAPAAAAPIHYDYDDGYYNQGQQYEYIPQYDQYS 180
            |..|.||.|.|| |.||   ..:.||.:|.|.|.|.|.|.          .|.....:|.|    
  Fly   119 HAAPAVVAHAAPAVVHA---APAYAPAIAHHVAAAPAVPY----------AGSLAHQVPAY---- 166

  Fly   181 GHYGHYASPYAGHY 194
            |:..|.|..:..||
  Fly   167 GYATHNAHAHVAHY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 40/51 (78%)
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130248at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.