DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr49Ag

DIOPT Version :10

Sequence 1:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster


Alignment Length:119 Identity:31/119 - (26%)
Similarity:47/119 - (39%) Gaps:40/119 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FVILSLALFASVAVARPG------------------YALDYYDHPKYAFN------YGVADHSTG 47
            |::.| ||..|..:|||.                  ...|..::...:||      .|:...:.|
  Fly     6 FLVCS-ALLLSYVLARPQDQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETSNGIRVENIG 69

  Fly    48 DVKS----QHETRDGDVV----------KGQYSLVEPDGSIRTVDYTADSIHGF 87
            .:|.    :.||.||.|:          .|.||..:|||::.|:.|.||. :||
  Fly    70 YLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADE-NGF 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 20/71 (28%)
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:459790 20/69 (29%)

Return to query results.
Submit another query.