DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:119 Identity:31/119 - (26%)
Similarity:40/119 - (33%) Gaps:42/119 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVV 91
            :|.| |..:....|:....:|.::...| .:|...||.|....|||.:..|||.||. :||    
  Fly   170 VDGY-HYLWETENGILGEESGRIEKLTE-EEGLRSKGFYEYTGPDGILYRVDYVADD-NGF---- 227

  Fly    92 TKSGPTVHAQAVVASPIVAHKPVLTHYEPQVVKHVAPVAHAPLVVASPAPYVAK 145
                          .|..||.|.                 ||    .|.|||.|
  Fly   228 --------------VPSAAHLPT-----------------AP----PPPPYVEK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 15/51 (29%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 17/56 (30%)

Return to query results.
Submit another query.