DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Bb and LOC1276643

DIOPT Version :10

Sequence 1:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster
Sequence 2:XP_316012.3 Gene:LOC1276643 / 1276643 VectorBaseID:AGAMI1_007835 Length:173 Species:Anopheles gambiae


Alignment Length:73 Identity:47/73 - (64%)
Similarity:52/73 - (71%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GY-ALDYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGF 87
            || ..|||.:|||.|.|||.|:.|||.|||.|.||||||||:|:|.|||||.|.|.|.|||.:||
Mosquito    62 GYEGKDYYAYPKYKFEYGVKDYHTGDHKSQWEVRDGDVVKGEYTLDEPDGSTRIVKYHADSKNGF 126

  Fly    88 NAVVTKSG 95
            .|||...|
Mosquito   127 EAVVKNIG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 34/51 (67%)
LOC1276643XP_316012.3 None

Return to query results.
Submit another query.