DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and CG34462

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:125 Identity:31/125 - (24%)
Similarity:56/125 - (44%) Gaps:22/125 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGFSFVVLCLLHIAHTQRGP-AGHIEFYSDYGRNHDEER-------LH-------YSHQYHISDV 54
            |.|.||::..::.|.:  .| :..||.|:......::||       :|       ||..|.|:|.
  Fly     9 WFFVFVLITKVYAALS--NPLSSKIEVYNQPEVTPEKERAKVRNYFVHEPYGPNTYSFGYEINDP 71

  Fly    55 ASRVHILHREQR--HGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVE-QRTGNSRV 111
            .::......|:|  :|. :.|||.:..|.|.|....|..: .:.|:.|.:: .:.|:.:|
  Fly    72 QTQNSQFREEKRFVNGS-IQGSYGYARPDGRIEVTKYMAK-EDGGYSAQIQIFKAGDEKV 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 14/45 (31%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:459790 15/52 (29%)

Return to query results.
Submit another query.