DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and LOC5667565

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_001688325.2 Gene:LOC5667565 / 5667565 VectorBaseID:AGAMI1_001760 Length:483 Species:Anopheles gambiae


Alignment Length:101 Identity:37/101 - (36%)
Similarity:47/101 - (46%) Gaps:23/101 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DYGRNHDEERLHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRG 97
            ||..|.     .||:.|||:|..:..:...:|.|.||.|:||||.:||.|..|.|.|.....| |
Mosquito   374 DYDPNP-----QYSYSYHIADALTGDNKEQQESRSGDVVTGSYSLVEPDGTRRVVEYTADPVN-G 432

  Fly    98 FKAVVEQRTGNSRVHQTLEFRSRQPIRALAIAEPVA 133
            |.|||.                |:|:...|:| |||
Mosquito   433 FNAVVH----------------REPLAVKAVA-PVA 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 20/43 (47%)
LOC5667565XP_001688325.2 None

Return to query results.
Submit another query.