DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and LOC4576978

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_001230823.3 Gene:LOC4576978 / 4576978 VectorBaseID:AGAMI1_002998 Length:187 Species:Anopheles gambiae


Alignment Length:103 Identity:34/103 - (33%)
Similarity:49/103 - (47%) Gaps:23/103 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YSDYGRNHDEERLHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGAN 95
            |::|..|.     .||:.|.::|..:..:...:|.|.||.|:||||.:||.|..|:|.|.....|
Mosquito    76 YAEYDANP-----QYSYSYAVADAVTGDNKNQQESRSGDVVTGSYSLVEPDGTRRTVEYNADPIN 135

  Fly    96 RGFKAVVEQRTGNSRVHQTLEFRSRQPIRALAIAEPVA 133
             ||.|||.                |:|:...|:| |:|
Mosquito   136 -GFNAVVH----------------REPLAVKAVA-PIA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 18/43 (42%)
LOC4576978XP_001230823.3 None

Return to query results.
Submit another query.