DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and Cpr92F

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:85 Identity:24/85 - (28%)
Similarity:38/85 - (44%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGNS 109
            :::.|..:|..|:   .|..:.|.....||||:::..||::||.| ....:.||.||........
  Fly    35 HTYSYGYADPNSQ---KHETRSHDGTTHGSYSYVDGHGHVQSVSY-TADPHHGFNAVGTNLPQAP 95

  Fly   110 RVHQTLEFRSRQPIRALAIA 129
            :||..       |:.|.|.|
  Fly    96 QVHAA-------PVYAAAHA 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 13/43 (30%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:459790 14/50 (28%)

Return to query results.
Submit another query.