DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and Ccp84Aa

DIOPT Version :9

Sequence 1:NP_001137868.1 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:92 Identity:28/92 - (30%)
Similarity:41/92 - (44%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGNS 109
            |...|.:.|..:..:....|:|.||.|.|.||.::..|:.|.|.|.....| ||.|||       
  Fly    62 YRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPIN-GFNAVV------- 118

  Fly   110 RVHQTLEFRSRQP-IRALAIAEPVAFV 135
                     :|:| ::|:|:|..|..|
  Fly   119 ---------NREPLVKAVAVAPVVKTV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_001137868.1 Chitin_bind_4 45..89 CDD:278791 14/43 (33%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.