DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and Ccp84Ab

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:92 Identity:28/92 - (30%)
Similarity:42/92 - (45%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGNS 109
            |...|.:.|..:..:....|:|.||.|.|.||.::..|:.|:|.|.....| ||.|||       
  Fly    62 YRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPIN-GFNAVV------- 118

  Fly   110 RVHQTLEFRSRQP-IRALAIAEPVAFV 135
                     :|:| ::|:|:|..|..|
  Fly   119 ---------NREPLVKAVAVAPVVKTV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 14/43 (33%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:459790 16/52 (31%)

Return to query results.
Submit another query.