DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr62Ba and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:88 Identity:29/88 - (32%)
Similarity:41/88 - (46%) Gaps:17/88 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGNS 109
            |::.|.:.|..|..:..|.|:|.||.|.|.||.::..|..|:|.|.....| ||.|||.      
  Fly    51 YTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSIN-GFNAVVR------ 108

  Fly   110 RVHQTLEFRSRQPIRALAIAEPV 132
                      |:|:.|:..|||:
  Fly   109 ----------REPLAAVVAAEPL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 16/43 (37%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 18/52 (35%)

Return to query results.
Submit another query.